PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009594706.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family WRKY
Protein Properties Length: 347aa    MW: 39078.1 Da    PI: 6.7909
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009594706.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY103.31.4e-32189246259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     +Dgy+WrKYGqK+vk+s fpr+YYrCtsa+C+vkk+ver+ +dp++v++tYeg+H+h+
  XP_009594706.1 189 EDGYRWRKYGQKTVKNSSFPRNYYRCTSASCNVKKRVERCFNDPSIVVTTYEGKHTHP 246
                     8********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.807.7E-35173248IPR003657WRKY domain
SuperFamilySSF1182903.01E-29180248IPR003657WRKY domain
PROSITE profilePS5081130.871183248IPR003657WRKY domain
SMARTSM007743.4E-38188247IPR003657WRKY domain
PfamPF031061.3E-25189246IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009624Biological Processresponse to nematode
GO:0009733Biological Processresponse to auxin
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MESYKDITIK MEDPMSYFDN FPVISNSFTG LVSDYNFAVE GKNNSINSSL GFMELLGVQD  60
FCSTSVFDVN SITTNLDQLL PKEEKYHIEP AVSISEEVKP SPAAESKKKI TVAAHESSNN  120
ILNTPSTPNS SSISSETNEG HAQDAEGEVA EEQITKTKLQ LKAKKTVNQK KQREPRIAFM  180
TKSEVDFLED GYRWRKYGQK TVKNSSFPRN YYRCTSASCN VKKRVERCFN DPSIVVTTYE  240
GKHTHPSPMN MNMNMINMPR PTLFPTRVFP LPAPTATFPL QMPFHINQSA QPHFNDLTTP  300
LASNLDHAAL VAHGRRFCSA PPSVEIMRDQ GLLQDLMSSR VVEEDYR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-261812481077Probable WRKY transcription factor 4
2lex_A2e-261812481077Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00069PBMTransfer from AT2G47260Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU0569161e-95EU056916.1 Solanum tuberosum WRKY transcription factor 4 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009594706.10.0PREDICTED: probable WRKY transcription factor 23
SwissprotO229007e-50WRK23_ARATH; Probable WRKY transcription factor 23
TrEMBLQ5DT881e-131Q5DT88_CAPAN; Transcription factor CaWRKY1
STRINGPGSC0003DMT4000233681e-114(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13092479
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47260.12e-44WRKY DNA-binding protein 23